Thrombin Receptor Antibody

Thrombin Receptor Antibody

Size

0,1 mg

Catalog no.

RP1092

Price

320 EUR

Buy

Gene Name

F2R

Entrez GeneID

2149

Raised in

rabbit

Uniprot ID

P25116

Analyses

WB,IHC-P

French translation

anticorps

Product form

freeze-dried

Reacts with species:

human, mouse, rat

Target antigen

Thrombin Receptor

Clonality

Polyclonal antibody

Clone

Polyclonal antibody

Type of the antibody

IgG polyclonal antibody

Purification

Immunogen affinity purified.

Protein Name

Proteinase-activated receptor 1

Gene Full Name

coagulation factor II (thrombin) receptor

Product configuration

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Solubilization

The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml

Properties

If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).

Tips

The Thrombin Receptor Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.

Synonyms

CF2R antibody|Coagulation factor II (thrombin) receptor antibody|Coagulation factor II receptor antibody|F2R antibody|HTR antibody|PAR 1 antibody|PAR-1 antibody|PAR1 antibody|PAR1_HUMAN antibody|Protease activated receptor 1 antibody|Proteinase activated receptor 1 antibody|Proteinase-activated receptor 1 antibody|Thrombin receptor antibody|TR antibody

Storage condtions

Keep the Thrombin Receptor Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.

Background

Proteinase-activated receptor 1 (PAR1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.

Related articles

1. Bahou, W. F., Nierman, W. C., Durkin, A. S., Potter, C. L., Demetrick, D. J. Chromosomal assignment of the human thrombin receptor gene: localization to region q13 of chromosome 5. Blood 82: 1532-1537, 1993. 2. Boire, A., Covic, L., Agarwal, A., Jacques, S., Sherifi, S., Kuliopulos, A. PAR1 is a matrix metalloprotease-1 receptor that promotes invasion and tumorigenesis of breast cancer cells. Cell 120: 303-131, 2005. 3. Coughlin, S. R., Vu, T.-K. H., Hung, D. T., Wheaton, V. I. Characterization of a functional thrombin receptor: issues and opportunities. J. Clin. Invest. 89: 351-355, 1992.

Description

The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.