PAR1 Antibody / F2R / Thrombin Receptor
Uniprot #
P25116
Category
Antibody
Tested applications
WB, IHC-P
French translation
anticorps
Localization
Cytoplasmic
Conjugation
Unconjugated
Purity
Antigen affinity
Clone
Polyclonal antibody
Form
Antigen affinity purified
Clonality
Polyclonal (rabbit origin)
Host animal
Rabbit (Oryctolagus cuniculus)
Recognised antigen
PAR1 / F2R / Thrombin Receptor
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Recommended dilutions
Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
Notes
Optimal dilution of the Thrombin Receptor antibody should be determined by the researcher.
Intented use
This Thrombin Receptor antibodyis to be used only for research purposes and not for diagnostics..
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Immunogen
Amino acids RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK of human PAR-1/Thrombin Receptor were used as the immunogen for the Thrombin Receptor antibody.
Species reactivity
Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
Storage
After reconstitution, the Thrombin Receptor antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
Description
Proteinase-activated receptor 1 (PAR-1), also known as the coagulation factor II (thrombin) receptor, is a protein that in humans is encoded by the F2R gene. By fluorescence in situ hybridization, this gene is mapped to 5q13, confirming its presence as a single locus in the human genome. PAR1 is a G protein-coupled receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. The expression of PAR1 is both required and sufficient to promote growth and invasion of breast carcinoma cells in a xenograft mouse model.
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.