PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

Size

0.1mg

Catalog no.

R32144

Price

406 EUR

Buy

Tested applications

WB

Uniprot #

P55085

Category

Antibody

French translation

anticorps

Conjugation

Unconjugated

Purity

Antigen affinity

Clone

Polyclonal antibody

Form

Antigen affinity purified

Recommended dilutions

Western blot: 0.1-0.5ug/ml

Clonality

Polyclonal (rabbit origin)

Host animal

Rabbit (Oryctolagus cuniculus)

Recognised antigen

PAR2 / F2RL1 / Thrombin Receptor-like 1

Concentration

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Notes

Optimal dilution of the PAR2 antibody should be determined by the researcher.

Intented use

This PAR2 antibodyis to be used only for research purposes and not for diagnostics..

Immunogen

Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.

Properties

If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Species reactivity

Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.

Storage

After reconstitution, the PAR2 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.

Additional description

The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.

Description

Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.